ALPPL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A6866
Artikelname: ALPPL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A6866
Hersteller Artikelnummer: A6866
Alternativnummer: ABB-A6866-100UL,ABB-A6866-20UL,ABB-A6866-1000UL,ABB-A6866-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GCAP, ALPPL, ALPPL2
There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 251
UniProt: P10696
Reinheit: Affinity purification
Sequenz: IIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQ
Target-Kategorie: ALPG
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates using ALPPL2 Rabbit pAb (A6866) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.