ALPPL2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ALPPL2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6866
• Hersteller Artikelnummer: A6866
• Alternativnummer: ABB-A6866-100UL,ABB-A6866-20UL,ABB-A6866-1000UL,ABB-A6866-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GCAP, ALPPL, ALPPL2

Produktbeschreibung

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 57kDa
• NCBI: 251
• UniProt: P10696
• Reinheit: Affinity purification
• Sequenz: IIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQ
• Target-Kategorie: ALPG
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ALPPL2 Rabbit pAb (A6866) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.