ATOX1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ATOX1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6874
• Hersteller Artikelnummer: A6874
• Alternativnummer: ABB-A6874-20UL,ABB-A6874-100UL,ABB-A6874-1000UL,ABB-A6874-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ATX1, HAH1, ATOX1

Produktbeschreibung

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 7kDa
• NCBI: 475
• UniProt: O00244
• Reinheit: Affinity purification
• Sequenz: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
• Target-Kategorie: ATOX1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ATOX1 Rabbit pAb (A6874) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.