15-PGDH/HPGD Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: 15-PGDH/HPGD Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6926
• Hersteller Artikelnummer: A6926
• Alternativnummer: ABB-A6926-100UL,ABB-A6926-20UL,ABB-A6926-1000UL,ABB-A6926-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PGDH, PGDH1, PHOAR1, 15-PGDH, SDR36C1, 15-PGDH/HPGD

Produktbeschreibung

This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 29kDa
• NCBI: 3248
• UniProt: P15428
• Reinheit: Affinity purification
• Sequenz: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQD
• Target-Kategorie: HPGD
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using 15-PGDH/HPGD Rabbit pAb (A6926) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.