LSS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6930
- Bilder (1)
| Artikelname: | LSS Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6930 |
| Hersteller Artikelnummer: | A6930 |
| Alternativnummer: | ABB-A6930-20UL,ABB-A6930-100UL,ABB-A6930-1000UL,ABB-A6930-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | OSC, APMR4, HYPT14, CTRCT44, LSS |
| The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 83kDa |
| NCBI: | 4047 |
| UniProt: | P48449 |
| Reinheit: | Affinity purification |
| Sequenz: | MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKAHTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLPAGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNILHKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYLPMSYCYAVRLSAAEDPL |
| Target-Kategorie: | LSS |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Lipids. Shipping: Ice Bag |

