PMS2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PMS2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6947
• Hersteller Artikelnummer: A6947
• Alternativnummer: ABB-A6947-20UL,ABB-A6947-100UL,ABB-A6947-500UL,ABB-A6947-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MLH4, PMS-2, PMSL2, HNPCC4, LYNCH4, MMRCS4, PMS2CL, PMS2

Produktbeschreibung

The protein encoded by this gene is a key component of the mismatch repair system that functions to correct DNA mismatches and small insertions and deletions that can occur during DNA replication and homologous recombination. This protein forms heterodimers with the gene product of the mutL homolog 1 (MLH1) gene to form the MutL-alpha heterodimer. The MutL-alpha heterodimer possesses an endonucleolytic activity that is activated following recognition of mismatches and insertion/deletion loops by the MutS-alpha and MutS-beta heterodimers, and is necessary for removal of the mismatched DNA. There is a DQHA(X)2E(X)4E motif found at the C-terminus of the protein encoded by this gene that forms part of the active site of the nuclease. Mutations in this gene have been associated with hereditary nonpolyposis colorectal cancer (HNPCC, also known as Lynch syndrome) and Turcot syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 96kDa
• NCBI: 5395
• UniProt: P54278
• Reinheit: Affinity purification
• Sequenz: MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQ
• Target-Kategorie: PMS2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PMS2 Rabbit pAb (A6947) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.