RORA Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RORA Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6971
• Hersteller Artikelnummer: A6971
• Alternativnummer: ABB-A6971-100UL,ABB-A6971-20UL,ABB-A6971-500UL,ABB-A6971-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ROR1, ROR2, ROR3, RZRA, NR1F1, RORa1, IDDECA, RORalpha, RZR-ALPHA, RORA

Produktbeschreibung

The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 53KDa/59kDa/61KDa/63KDa
• NCBI: 6095
• UniProt: P35398
• Reinheit: Affinity purification
• Sequenz: QPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
• Target-Kategorie: RORA
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat liver, using RORA Rabbit pAb (A6971) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.