CLASP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CLASP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7081
• Hersteller Artikelnummer: A7081
• Alternativnummer: ABB-A7081-100UL,ABB-A7081-20UL,ABB-A7081-500UL,ABB-A7081-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MAST1, CLASP1

Produktbeschreibung

CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170, MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 169kDa
• NCBI: 23332
• UniProt: Q7Z460
• Reinheit: Affinity purification
• Sequenz: IMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRAQTTNSNSSSSSDVSTHS
• Target-Kategorie: CLASP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CLASP1 Rabbit pAb (A7081) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.