KCNIP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7100
Artikelname: KCNIP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7100
Hersteller Artikelnummer: A7100
Alternativnummer: ABB-A7100-100UL,ABB-A7100-20UL,ABB-A7100-1000UL,ABB-A7100-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KCHIP2, KCNIP2
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 30819
UniProt: Q9NS61
Reinheit: Affinity purification
Sequenz: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQ
Target-Kategorie: KCNIP2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience,Cardiovascular,Heart,Cardiac arrhythmias. Shipping: Ice Bag
Western blot analysis of various lysates using KCNIP2 Rabbit pAb (A7100) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.