ART5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7146
Artikelname: ART5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7146
Hersteller Artikelnummer: A7146
Alternativnummer: ABB-A7146-100UL,ABB-A7146-20UL,ABB-A7146-1000UL,ABB-A7146-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ARTC5, ART5
The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Several transcripts encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 116969
UniProt: Q96L15
Reinheit: Affinity purification
Sequenz: VPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLF
Target-Kategorie: ART5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using ART5 Rabbit pAb (A7146) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.