EPHA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7183
- Bilder (1)
| Artikelname: | EPHA2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7183 |
| Hersteller Artikelnummer: | A7183 |
| Alternativnummer: | ABB-A7183-20UL,ABB-A7183-100UL,ABB-A7183-500UL,ABB-A7183-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ECK, CTPA, ARCC2, CTPP1, CTRCT6, EPHA2 |
| This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Mutations in this gene are the cause of certain genetically-related cataract disorders. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 108kDa |
| NCBI: | 1969 |
| UniProt: | P29317 |
| Reinheit: | Affinity purification |
| Sequenz: | FFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPE |
| Target-Kategorie: | EPHA2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Signal Transduction,Kinase,Tyrosine kinases,Neuroscience, Cell Type Marker,Cardiovascular,Angiogenesis,Neuron marker. Shipping: Ice Bag |

