TRIAP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TRIAP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7313
• Hersteller Artikelnummer: A7313
• Alternativnummer: ABB-A7313-100UL,ABB-A7313-20UL,ABB-A7313-1000UL,ABB-A7313-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: WF-1, MDM35, P53CSV, HSPC132, TRIAP1

Produktbeschreibung

Enables p53 binding activity. Contributes to phosphatidic acid transfer activity. Involved in several processes, including DNA damage response, signal transduction by p53 class mediator, negative regulation of apoptotic process, and positive regulation of phospholipid transport. Located in mitochondrial intermembrane space and nucleoplasm. Part of protein-containing complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 9kDa
• NCBI: 51499
• UniProt: O43715
• Reinheit: Affinity purification
• Sequenz: MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS
• Target-Kategorie: TRIAP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using TRIAP1 Rabbit pAb (A7313) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.