MAP4K3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MAP4K3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7351
• Hersteller Artikelnummer: A7351
• Alternativnummer: ABB-A7351-100UL,ABB-A7351-20UL,ABB-A7351-1000UL,ABB-A7351-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GLK, MEKKK3, MEKKK 3, MAPKKKK3, RAB8IPL1, MAP4K3

Produktbeschreibung

This gene encodes a member of the mitogen-activated protein kinase kinase kinase kinase family. The encoded protein activates key effectors in cell signalling, among them c-Jun. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 101kDa
• NCBI: 8491
• UniProt: Q8IVH8
• Reinheit: Affinity purification
• Sequenz: ETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY
• Target-Kategorie: MAP4K3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using MAP4K3 Rabbit pAb (A7351) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.