FASTKD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7384
- Bilder (1)
| Artikelname: | FASTKD1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7384 |
| Hersteller Artikelnummer: | A7384 |
| Alternativnummer: | ABB-A7384-20UL,ABB-A7384-100UL,ABB-A7384-500UL,ABB-A7384-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FASTKD1 |
| Enables RNA binding activity. Involved in mitochondrial RNA metabolic process and regulation of mitochondrial mRNA stability. Located in mitochondrion. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 97kDa |
| NCBI: | 79675 |
| UniProt: | Q53R41 |
| Reinheit: | Affinity purification |
| Sequenz: | KFLARLDSQLEILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKGIGGMDGTQQQIFKMLAEVLGGINCVKASVLTPYYHKVDFECILDKRKKPLPYGSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDARMDYLRECIFGEVKSCL |
| Target-Kategorie: | FASTKD1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Kinase,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag |

