SETDB2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SETDB2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7391
• Hersteller Artikelnummer: A7391
• Alternativnummer: ABB-A7391-20UL,ABB-A7391-100UL,ABB-A7391-500UL,ABB-A7391-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CLLD8, CLLL8, KMT1F, C13orf4, SETDB2

Produktbeschreibung

This gene encodes a member of a family of proteins that contain a methyl-CpG-binding domain (MBD) and a SET domain and function as histone methyltransferases. This protein is recruited to heterochromatin and plays a role in the regulation of chromosome segregation. This region is commonly deleted in chronic lymphocytic leukemia. Naturally-occuring readthrough transcription occurs from this gene to the downstream PHF11 (PHD finger protein 11) gene. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 82kDa
• NCBI: 83852
• UniProt: Q96T68
• Reinheit: Affinity purification
• Sequenz: SGACLMKMPLNLKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEVVSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSCDCSEGCIDITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRVVQHGPQVRLQVFKTEQKG
• Target-Kategorie: SETDB2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SETDB2 Rabbit pAb (A7391) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.