ATG4C Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ATG4C Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7396
• Hersteller Artikelnummer: A7396
• Alternativnummer: ABB-A7396-100UL,ABB-A7396-20UL,ABB-A7396-1000UL,ABB-A7396-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: APG4C, AUTL1, AUTL3, APG4-C, HsAPG4C, ATG4C

Produktbeschreibung

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 52kDa
• NCBI: 84938
• UniProt: Q96DT6
• Reinheit: Affinity purification
• Sequenz: MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKI
• Target-Kategorie: ATG4C
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Cell Biology Developmental Biology,Autophagy,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Cardiovascular,Heart. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ATG4C Rabbit pAb (A7396) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.