SPIB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7451
- Bilder (1)
| Artikelname: | SPIB Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7451 |
| Hersteller Artikelnummer: | A7451 |
| Alternativnummer: | ABB-A7451-100UL,ABB-A7451-20UL,ABB-A7451-500UL,ABB-A7451-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SPI-B, SPIB |
| The protein encoded by this gene is a transcriptional activator that binds to the PU-box (5-GAGGAA-3) and acts as a lymphoid-specific enhancer. Four transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 29kDa |
| NCBI: | 6689 |
| UniProt: | Q01892 |
| Reinheit: | Affinity purification |
| Sequenz: | MLALEAAQLDGPHFSCLYPDGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVPATPYEAFDPAAAAFSHPQAAQLCYEPPTYSPAGNLELAPSLEAPGPGLPAYPTENFASQTLVPPAYAPYPSPVLSEEEDLPLDSPALEVSDSESDEALVAGPEGKGSEAGTRKKLRLYQFLLGLLTRGDMRECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSAL |
| Target-Kategorie: | SPIB |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |

