TM9SF1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TM9SF1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7461
• Hersteller Artikelnummer: A7461
• Alternativnummer: ABB-A7461-100UL,ABB-A7461-20UL,ABB-A7461-500UL,ABB-A7461-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MP70, HMP70, TM9SF1

Produktbeschreibung

Predicted to be involved in protein localization to membrane. Predicted to be located in autophagosome membrane, cytoplasmic vesicle, and lysosomal membrane. Predicted to be integral component of membrane. Predicted to be active in membrane.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 69kDa
• NCBI: 10548
• UniProt: O15321
• Reinheit: Affinity purification
• Sequenz: PGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPR
• Target-Kategorie: TM9SF1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using TM9SF1 Rabbit pAb (A7461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.