VENTX Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7467
- Bilder (1)
| Artikelname: | VENTX Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7467 |
| Hersteller Artikelnummer: | A7467 |
| Alternativnummer: | ABB-A7467-100UL,ABB-A7467-20UL,ABB-A7467-500UL,ABB-A7467-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NA88A, HPX42B, VENTX2, VENTX |
| This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 28kDa |
| NCBI: | 27287 |
| UniProt: | O95231 |
| Reinheit: | Affinity purification |
| Sequenz: | MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTG |
| Target-Kategorie: | VENTX |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |

