CNDP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CNDP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7485
• Hersteller Artikelnummer: A7485
• Alternativnummer: ABB-A7485-100UL,ABB-A7485-20UL,ABB-A7485-1000UL,ABB-A7485-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CN1, CPGL2, HsT2308, CNDP1

Produktbeschreibung

This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 57kDa
• NCBI: 84735
• UniProt: Q96KN2
• Reinheit: Affinity purification
• Sequenz: MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKC
• Target-Kategorie: CNDP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CNDP1 Rabbit pAb (A7485) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.