ELF2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ELF2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7487
• Hersteller Artikelnummer: A7487
• Alternativnummer: ABB-A7487-20UL,ABB-A7487-100UL,ABB-A7487-1000UL,ABB-A7487-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EU32, NERF, NERF-2, NERF-1A, NERF-1B, NERF-1a, b, ELF2

Produktbeschreibung

Enables DNA-binding transcription factor activity, RNA polymerase II-specific and sequence-specific double-stranded DNA binding activity. Involved in negative regulation of transcription, DNA-templated, positive regulation of transcription, DNA-templated, and regulation of transcription by RNA polymerase II. Located in cytosol and nuclear body.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 64kDa
• NCBI: 1998
• UniProt: Q15723
• Reinheit: Affinity purification
• Sequenz: MATSLHEGPTNQLDLLIRAVEASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKP
• Target-Kategorie: ELF2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ELF2 Rabbit pAb (A7487) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.