DNAJB9 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: DNAJB9 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7494
• Hersteller Artikelnummer: A7494
• Alternativnummer: ABB-A7494-100UL,ABB-A7494-20UL,ABB-A7494-1000UL,ABB-A7494-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MDG1, ERdj4, MDG-1, MST049, MSTP049, DNAJB9

Produktbeschreibung

This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 26kDa
• NCBI: 4189
• UniProt: Q9UBS3
• Reinheit: Affinity purification
• Sequenz: SKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
• Target-Kategorie: DNAJB9
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using DNAJB9 Rabbit pAb (A7494) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.