PPP3R2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PPP3R2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7495
• Hersteller Artikelnummer: A7495
• Alternativnummer: ABB-A7495-20UL,ABB-A7495-100UL,ABB-A7495-1000UL,ABB-A7495-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PPP3RL, PPP3R2

Produktbeschreibung

Predicted to enable calcium ion binding activity and calcium-dependent protein serine/threonine phosphatase regulator activity. Predicted to be involved in regulation of catalytic activity. Predicted to act upstream of or within penetration of zona pellucida. Predicted to be located in sperm mitochondrial sheath. Predicted to be part of calcineurin complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 20kDa
• NCBI: 5535
• UniProt: Q96LZ3
• Reinheit: Affinity purification
• Sequenz: MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
• Target-Kategorie: PPP3R2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,ErbB-HER Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Neuroscience,Calcium Signaling,Neurodegenerative Diseases. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PPP3R2 Rabbit pAb (A7495) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.