ZNF24 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7500
Artikelname: ZNF24 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7500
Hersteller Artikelnummer: A7500
Alternativnummer: ABB-A7500-100UL,ABB-A7500-20UL,ABB-A7500-500UL,ABB-A7500-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191, ZNF24
Enables DNA-binding transcription activator activity, RNA polymerase II-specific, identical protein binding activity, and sequence-specific DNA binding activity. Involved in negative regulation of transcription, DNA-templated and positive regulation of transcription by RNA polymerase II. Located in nucleoplasm.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 7572
UniProt: P17028
Reinheit: Affinity purification
Sequenz: LDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV
Target-Kategorie: ZNF24
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates, using ZNF24 Rabbit pAb (A7500) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.