ZNF24 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7500
- Bilder (1)
| Artikelname: | ZNF24 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7500 |
| Hersteller Artikelnummer: | A7500 |
| Alternativnummer: | ABB-A7500-100UL,ABB-A7500-20UL,ABB-A7500-500UL,ABB-A7500-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191, ZNF24 |
| Enables DNA-binding transcription activator activity, RNA polymerase II-specific, identical protein binding activity, and sequence-specific DNA binding activity. Involved in negative regulation of transcription, DNA-templated and positive regulation of transcription by RNA polymerase II. Located in nucleoplasm. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 42kDa |
| NCBI: | 7572 |
| UniProt: | P17028 |
| Reinheit: | Affinity purification |
| Sequenz: | LDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV |
| Target-Kategorie: | ZNF24 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |

