RAB31 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RAB31 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7506
• Hersteller Artikelnummer: A7506
• Alternativnummer: ABB-A7506-100UL,ABB-A7506-20UL,ABB-A7506-1000UL,ABB-A7506-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Rab22B, RAB31

Produktbeschreibung

Enables GDP binding activity and GTP binding activity. Involved in several processes, including Golgi to plasma membrane protein transport, cellular response to insulin stimulus, and receptor internalization. Located in early endosome, phagocytic vesicle, and trans-Golgi network membrane. Biomarker of severe acute respiratory syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 22kDa
• NCBI: 11031
• UniProt: Q13636
• Reinheit: Affinity purification
• Sequenz: MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
• Target-Kategorie: RAB31
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using RAB31 Rabbit pAb (A7506) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.