TRIM29 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7508
- Bilder (1)
| Artikelname: | TRIM29 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7508 |
| Hersteller Artikelnummer: | A7508 |
| Alternativnummer: | ABB-A7508-100UL,ABB-A7508-20UL,ABB-A7508-1000UL,ABB-A7508-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ATDC, TRIM29 |
| The protein encoded by this gene belongs to the TRIM protein family. It has multiple zinc finger motifs and a leucine zipper motif. It has been proposed to form homo- or heterodimers which are involved in nucleic acid binding. Thus, it may act as a transcriptional regulatory factor involved in carcinogenesis and/or differentiation. It may also function in the suppression of radiosensitivity since it is associated with ataxia telangiectasia phenotype. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 66kDa |
| NCBI: | 23650 |
| UniProt: | Q14134 |
| Reinheit: | Affinity purification |
| Sequenz: | ILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSG |
| Target-Kategorie: | TRIM29 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation. Shipping: Ice Bag |

