CSNK1G1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CSNK1G1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7510
• Hersteller Artikelnummer: A7510
• Alternativnummer: ABB-A7510-20UL,ABB-A7510-100UL,ABB-A7510-1000UL,ABB-A7510-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CK1gamma1, CSNK1G1

Produktbeschreibung

This gene encodes a member of the casein kinase I gene family. This family is comprised of serine/threonine kinases that phosphorylate acidic proteins such as caseins. The encoded kinase plays a role in cell cycle checkpoint arrest in response to stalled replication forks by phosphorylating Claspin. A mutation in this gene may be associated with non-syndromic early-onset epilepsy (NSEOE).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 49kDa
• NCBI: 53944
• UniProt: Q9HCP0
• Reinheit: Affinity purification
• Sequenz: FFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQRHK
• Target-Kategorie: CSNK1G1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Kinase,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CSNK1G1 Rabbit pAb (A7510) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.