[KO Validated] RAB1B Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: [KO Validated] RAB1B Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7514
• Hersteller Artikelnummer: A7514
• Alternativnummer: ABB-A7514-100UL,ABB-A7514-20UL,ABB-A7514-1000UL,ABB-A7514-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RAB1B

Produktbeschreibung

Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196], Alvarez et al., 2003 [PubMed 12802079]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 22kDa
• NCBI: 81876
• UniProt: Q9H0U4
• Reinheit: Affinity purification
• Sequenz: YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
• Target-Kategorie: RAB1B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type (WT) and RAB1B knockout (KO)HeLa cellsusing[KO Validated] RAB1B Rabbit pAb RAB1B Rabbit pAb (A7514) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.