SESN2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SESN2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A7515
• Hersteller Artikelnummer: A7515
• Alternativnummer: ABB-A7515-20UL,ABB-A7515-100UL,ABB-A7515-500UL,ABB-A7515-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HI95, SES2, SEST2, SESN2

Produktbeschreibung

This gene encodes a member of the sestrin family of PA26-related proteins. The encoded protein may function in the regulation of cell growth and survival. This protein may be involved in cellular response to different stress conditions.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 54kDa
• NCBI: 83667
• UniProt: P58004
• Reinheit: Affinity purification
• Sequenz: VFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQ
• Target-Kategorie: SESN2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Endocrine Metabolism,AMPK Signaling Pathway,Endocrine and metabolic diseases,Obesity,Cardiovascular,Hypoxia. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from K-562 cells, using SESN2 Rabbit pAb (A7515) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.