PPP6R2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PPP6R2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A8359
• Hersteller Artikelnummer: A8359
• Alternativnummer: ABB-A8359-100UL,ABB-A8359-20UL,ABB-A8359-500UL,ABB-A8359-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PP6R2, SAPS2, SAP190, KIAA0685, PPP6R2

Produktbeschreibung

The protein encoded by this gene is a regulatory protein for the protein phosphatase-6 catalytic subunit. Together, these proteins act as a significant T-loop phosphatase for Aurora A, an essential mitotic kinase. Loss of function of either the regulatory or catalytic subunit of protein phosphatase-6 interferes with spindle formation and chromosome alignment.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 105kDa
• NCBI: 9701
• UniProt: O75170
• Reinheit: Affinity purification
• Sequenz: EDSDTRCAARVMARPRFGAPHASESCSKNGPERGGQDGKASLEAHRDAPGAGAPPAPGKKEAPPVEGDSEGAMWTAVFDEPANSTPTAPGVVRDVGSSVWAAGTSAPEEKGWAKFTDFQPFCCSESGPRCSSPVDTECSHAEGSRSQGPEKAFSPASPCAWNVCVTRKAPLLASDSSSSGGSHSEDGDQKAASAMDAVSRGPGREAPPLPTVARTEEAVGRVGCADSRLLSPACPAPKEVTAAPAVAVPPEATVA
• Target-Kategorie: PPP6R2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PPP6R2 Rabbit pAb (A8359) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.