ANKRD28 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ANKRD28 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A8365
• Hersteller Artikelnummer: A8365
• Alternativnummer: ABB-A8365-100UL,ABB-A8365-20UL,ABB-A8365-500UL,ABB-A8365-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PITK, FAP79, CFAP79, PPP1R65, ANKRD28

Produktbeschreibung

Predicted to be located in cytosol and nucleoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 113kDa
• NCBI: 23243
• UniProt: O15084
• Reinheit: Affinity purification
• Sequenz: MAFLKLRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVV
• Target-Kategorie: ANKRD28
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ANKRD28 Rabbit pAb (A8365) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.