DLX2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: DLX2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8410
• Hersteller Artikelnummer: A8410
• Alternativnummer: ABB-A8410-100UL,ABB-A8410-20UL,ABB-A8410-500UL,ABB-A8410-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TES1, TES-1, DLX2

Produktbeschreibung

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 34kDa
• NCBI: 1746
• UniProt: Q07687
• Reinheit: Affinity purification
• Sequenz: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPEKEDLEP
• Target-Kategorie: DLX2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience,Stem Cells,Neural Stem Cells.

Bilder

Western blot analysis of various lysates, using DLX2 Rabbit pAb (A8410) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.