Glucosylceramidase beta (GBA) Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Glucosylceramidase beta (GBA) Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8420
• Hersteller Artikelnummer: A8420
• Alternativnummer: ABB-A8420-100UL,ABB-A8420-20UL,ABB-A8420-1000UL,ABB-A8420-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GBA, GCB, GLUC, Glucosylceramidase beta (GBA)

Produktbeschreibung

This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 60kDa
• NCBI: 2629
• UniProt: P04062
• Reinheit: Affinity purification
• Sequenz: ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWAR
• Target-Kategorie: GBA1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease.

Bilder

Western blot analysis of lysates from MCF-7 cells, using Glucosylceramidase beta (GBA) Rabbit pAb (A8420) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.