GTF2H4 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: GTF2H4 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8425
• Hersteller Artikelnummer: A8425
• Alternativnummer: ABB-A8425-20UL,ABB-A8425-100UL,ABB-A8425-1000UL,ABB-A8425-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: P52, TFB2, TFIIH, GTF2H4

Produktbeschreibung

Enables RNA polymerase II general transcription initiation factor activity. Involved in transcription by RNA polymerase II. Located in nuclear speck. Part of core TFIIH complex portion of holo TFIIH complex and transcription factor TFIID complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 52kDa
• NCBI: 2968
• UniProt: Q92759
• Reinheit: Affinity purification
• Sequenz: MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMS
• Target-Kategorie: GTF2H4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair.

Bilder

Western blot analysis of various lysates using GTF2H4 Rabbit pAb (A8425) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.