RARS2 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A8503
- Bilder (1)
| Artikelname: | RARS2 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A8503 |
| Hersteller Artikelnummer: | A8503 |
| Alternativnummer: | ABB-A8503-100UL,ABB-A8503-20UL,ABB-A8503-1000UL,ABB-A8503-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PCH6, ArgRS, RARSL, DALRD2, PRO1992, RARS2 |
| This nuclear gene encodes a protein that localizes to the mitochondria, where it catalyzes the transfer of L-arginine to its cognate tRNA, an important step in translation of mitochondrially-encoded proteins. Defects in this gene are a cause of pontocerebellar hypoplasia type 6 (PCH6). Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 66kDa |
| NCBI: | 57038 |
| UniProt: | Q5T160 |
| Reinheit: | Affinity purification |
| Sequenz: | LNLPPENLITSISAVPISQKEEVADFQLSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVIRINYLGDWGMQFGLLGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEAADDKSVAKAAQEFFQRLELGDVQALSLWQKFRDLSIEEYIRVYKRLGVYFDEYSGESF |
| Target-Kategorie: | RARS2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism. |
|
|
Western blot analysis of various lysates using RARS2 Rabbit pAb (A8503) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s. |
Produktgarantie und fachkundiger Support
