CALCRL Rabbit pAb, Unconjugated

Artikelnummer: ABB-A8533
Artikelname: CALCRL Rabbit pAb, Unconjugated
Artikelnummer: ABB-A8533
Hersteller Artikelnummer: A8533
Alternativnummer: ABB-A8533-20UL,ABB-A8533-100UL,ABB-A8533-1000UL,ABB-A8533-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CRLR, CGRPR, LMPHM8, CALCRL
Enables adrenomedullin binding activity, adrenomedullin receptor activity, and calcitonin gene-related peptide receptor activity. Involved in several processes, including G protein-coupled receptor signaling pathway, cellular response to sucrose stimulus, and receptor internalization. Located in endoplasmic reticulum, endosome, and lysosome. Part of CGRP receptor complex and adrenomedullin receptor complex. Colocalizes with plasma membrane. Implicated in hereditary lymphedema.
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 10203
UniProt: Q16602
Reinheit: Affinity purification
Sequenz: GIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Target-Kategorie: CALCRL
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience,Calcium Signaling.
Western blot analysis of various lysates using CALCRL Rabbit pAb (A8533) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.