MSH4 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MSH4 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8556
• Hersteller Artikelnummer: A8556
• Alternativnummer: ABB-A8556-100UL,ABB-A8556-20UL,ABB-A8556-1000UL,ABB-A8556-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ASG, POF20, SPGF2, MSH4

Produktbeschreibung

This gene encodes a member of the DNA mismatch repair mutS family. This member is a meiosis-specific protein that is not involved in DNA mismatch correction, but is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis I. This protein and MSH5 form a heterodimer which binds uniquely to a Holliday Junction and its developmental progenitor, thus provoking ADP-ATP exchange, and stabilizing the interaction between parental chromosomes during meiosis double-stranded break repair.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 105kDa
• NCBI: 4438
• UniProt: O15457
• Reinheit: Affinity purification
• Sequenz: QIMAQIGSYVPAEYSSFRIAKQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGICYAVCEYLLSLKAFTLFATHFLELCHIDALYPNVENMHFEVQHVKNTSRNKEAILYTYKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE
• Target-Kategorie: MSH4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair.

Bilder

Western blot analysis of various lysates using MSH4 Rabbit pAb (A8556) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.