MIB1/DIP1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MIB1/DIP1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8588
• Hersteller Artikelnummer: A8588
• Alternativnummer: ABB-A8588-100UL,ABB-A8588-20UL,ABB-A8588-500UL,ABB-A8588-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MIB, DIP1, ZZZ6, DIP-1, LVNC7, ZZANK2, MIB1/DIP1

Produktbeschreibung

This gene encodes a protein containing multiple ankyrin repeats and RING finger domains that functions as an E3 ubiquitin ligase. The encoded protein positively regulates Notch signaling by ubiquitinating the Notch receptors, thereby facilitating their endocytosis. This protein may also promote the ubiquitination and degradation of death-associated protein kinase 1 (DAPK1).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 110kDa
• NCBI: 57534
• UniProt: Q86YT6
• Reinheit: Affinity purification
• Sequenz: DSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSE
• Target-Kategorie: MIB1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Stem Cells.

Bilder

Western blot analysis of various lysates using MIB1/DIP1 Rabbit pAb (A8588) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.