BPIFA1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: BPIFA1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8634
• Hersteller Artikelnummer: A8634
• Alternativnummer: ABB-A8634-20UL,ABB-A8634-100UL,ABB-A8634-1000UL,ABB-A8634-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LUNX, NASG, PLUNC, SPURT, SPLUNC1, bA49G10.5, BPIFA1

Produktbeschreibung

This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3 UTR have been detected, but the full-length nature of only three are known.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 27kDa
• NCBI: 51297
• UniProt: Q9NP55
• Reinheit: Affinity purification
• Sequenz: QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
• Target-Kategorie: BPIFA1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Cancer,Tumor biomarkers.

Bilder

Western blot analysis of various lysates using BPIFA1 Rabbit pAb (A8634) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.