CRIP2 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A9038
- Bilder (1)
| Artikelname: | CRIP2 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A9038 |
| Hersteller Artikelnummer: | A9038 |
| Alternativnummer: | ABB-A9038-20UL,ABB-A9038-100UL,ABB-A9038-500UL,ABB-A9038-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CRIP, CRP2, ESP1, CRIP2 |
| This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 22kDa |
| NCBI: | 1397 |
| UniProt: | P52943 |
| Reinheit: | Affinity purification |
| Sequenz: | MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP |
| Target-Kategorie: | CRIP2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling. |

