POMP Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: POMP Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9067
• Hersteller Artikelnummer: A9067
• Alternativnummer: ABB-A9067-20UL,ABB-A9067-100UL,ABB-A9067-1000UL,ABB-A9067-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: UMP1, PRAAS2, HSPC014, C13orf12, PNAS-110, POMP

Produktbeschreibung

The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5 UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 16kDa
• NCBI: 51371
• UniProt: Q9Y244
• Reinheit: Affinity purification
• Sequenz: MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL
• Target-Kategorie: POMP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Signal Transduction,Cell Biology Developmental Biology.

Bilder

Western blot analysis of various lysates using POMP Rabbit pAb (A9067) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.