MYL12A Rabbit pAb, Unconjugated

Artikelnummer: ABB-A9176
Artikelname: MYL12A Rabbit pAb, Unconjugated
Artikelnummer: ABB-A9176
Hersteller Artikelnummer: A9176
Alternativnummer: ABB-A9176-20UL,ABB-A9176-100UL,ABB-A9176-1000UL,ABB-A9176-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MLCB, MRCL3, MRLC3, MYL2B, MLC-2B, HEL-S-24, MYL12A
This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 10627
UniProt: P19105
Reinheit: Affinity purification
Sequenz: KLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Target-Kategorie: MYL12A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins,Actins.
Western blot analysis of various lysates using MYL12A Rabbit pAb (A9176) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.