DEPDC6 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: DEPDC6 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9447
• Hersteller Artikelnummer: A9447
• Alternativnummer: ABB-A9447-100UL,ABB-A9447-20UL,ABB-A9447-1000UL,ABB-A9447-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DEP.6, DEPDC6

Produktbeschreibung

Involved in several processes, including negative regulation of TOR signaling, negative regulation of cell size, and negative regulation of protein kinase activity.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 46kDa
• NCBI: 64798
• UniProt: Q8TB45
• Reinheit: Affinity purification
• Sequenz: MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQF
• Target-Kategorie: DEPTOR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway.

Bilder

Western blot analysis of various lysates using DEPDC6 Rabbit pAb (A9447) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.