SLC34A2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SLC34A2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9460
• Hersteller Artikelnummer: A9460
• Alternativnummer: ABB-A9460-100UL,ABB-A9460-20UL,ABB-A9460-500UL,ABB-A9460-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PULAM, NPTIIb, NaPi2b, NAPI-3B, NAPI-IIb, SLC34A2

Produktbeschreibung

The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 76kDa
• NCBI: 10568
• UniProt: O95436
• Reinheit: Affinity purification
• Sequenz: EVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLA
• Target-Kategorie: SLC34A2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Endocrine Metabolism.

Bilder

Western blot analysis of various lysates using SLC34A2 Rabbit pAb (A9460) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.