SYCP3 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SYCP3 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9548
• Hersteller Artikelnummer: A9548
• Alternativnummer: ABB-A9548-20UL,ABB-A9548-100UL,ABB-A9548-500UL,ABB-A9548-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: COR1, SCP3, SPGF4, RPRGL4, SYCP3

Produktbeschreibung

This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 28kDa
• NCBI: 50511
• UniProt: Q8IZU3
• Reinheit: Affinity purification
• Sequenz: MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
• Target-Kategorie: SYCP3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle.

Bilder

Western blot analysis of various lysates using SYCP3 Rabbit pAb (A9548) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.