ZRANB3 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ZRANB3 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9555
• Hersteller Artikelnummer: A9555
• Alternativnummer: ABB-A9555-100UL,ABB-A9555-20UL,ABB-A9555-500UL,ABB-A9555-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AH2, 4933425L19Rik, ZRANB3

Produktbeschreibung

Enables ATP-dependent DNA/DNA annealing activity, K63-linked polyubiquitin modification-dependent protein binding activity, and endodeoxyribonuclease activity. Involved in several processes, including DNA metabolic process, DNA rewinding, and negative regulation of DNA recombination. Located in nuclear replication fork and nucleoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 123kDa
• NCBI: 84083
• UniProt: Q5FWF4
• Reinheit: Affinity purification
• Sequenz: ITKQQTKQNCTKRYITKEDVAVASMDKVKNVGGHVRLITKESRPRDPFTKKLLEDGACVPFLNPYTVQADLTVKPSTSKGYLQAVDNEGNPLCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWTSKLPLEQLNEMIRNPGEGHFWQVDHIKPVYGGGGQCSLDNLQTLCTVCHKERTARQAKERSQVRRQSLASKHGSDITR
• Target-Kategorie: ZRANB3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:3000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling.

Bilder

Western blot analysis of various lysates using ZRANB3 Rabbit pAb (A9555) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.