PHOX2B Rabbit pAb, Unconjugated

Artikelnummer: ABB-A9685
Artikelname: PHOX2B Rabbit pAb, Unconjugated
Artikelnummer: ABB-A9685
Hersteller Artikelnummer: A9685
Alternativnummer: ABB-A9685-20UL,ABB-A9685-100UL,ABB-A9685-1000UL,ABB-A9685-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CCHS, PMX2B, NBLST2, NBPhox, PHOX2B
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations and the determination of neurotransmitter phenotype. The gene product is linked to enhancement of second messenger-mediated activation of the dopamine beta-hydroylase, c-fos promoters and several enhancers, including cyclic amp-response element and serum-response element. Expansion of a 20 amino acid polyalanine tract in this protein by 5-13 aa has been associated with congenital central hypoventilation syndrome.
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 8929
UniProt: Q99453
Reinheit: Affinity purification
Sequenz: MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHG
Target-Kategorie: PHOX2B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience.
Western blot analysis of various lysates using PHOX2B Rabbit pAb (A9685) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.