UACA Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: UACA Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9713
• Hersteller Artikelnummer: A9713
• Alternativnummer: ABB-A9713-100UL,ABB-A9713-20UL,ABB-A9713-1000UL,ABB-A9713-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NUCLING, UACA

Produktbeschreibung

This gene encodes a protein that contains ankyrin repeats and coiled coil domains and likely plays a role in apoptosis. Studies in rodents have implicated the encoded protein in the stimulation of apoptosis and the regulation of mammary gland involution, in which the mammary gland returns to its pre-pregnant state. This protein has also been proposed to negatively regulate apoptosis based on experiments in human cell lines in which the protein was shown to interact with PRKC apoptosis WT1 regulator protein, also known as PAR-4, and inhibit translocation of the PAR-4 receptor. Autoantibodies to this protein have been identified in human patients with panuveitis and Graves disease. Differential expression of this gene has been observed in various human cancers.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 163kDa
• NCBI: 55075
• UniProt: Q9BZF9
• Reinheit: Affinity purification
• Sequenz: MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVNPGKLDVEGRSVFHVVTSKGNLECLNAILIH
• Target-Kategorie: UACA
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation.

Bilder

Western blot analysis of various lysates using UACA Rabbit pAb (A9713) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.