GNG3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A9817
Artikelname: GNG3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A9817
Hersteller Artikelnummer: A9817
Alternativnummer: ABB-A9817-100UL,ABB-A9817-20UL,ABB-A9817-500UL,ABB-A9817-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HG3D, GNG3
Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The gamma subunit determines the specificity of which signaling pathways will be affected by this particular complex. The protein encoded by this gene represents the gamma subunit of both inhibitory and stimulatory complexes.
Klonalität: Polyclonal
Molekulargewicht: 8kDa
NCBI: 2785
UniProt: P63215
Reinheit: Affinity purification
Sequenz: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL
Target-Kategorie: GNG3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,G protein signaling,Small G proteins,mTOR Signaling Pathway,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease.
Western blot analysis of various lysates using GNG3 Rabbit pAb (A9817) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.