PPIC Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A9837
- Bilder (1)
| Artikelname: | PPIC Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A9837 |
| Hersteller Artikelnummer: | A9837 |
| Alternativnummer: | ABB-A9837-20UL,ABB-A9837-100UL,ABB-A9837-500UL,ABB-A9837-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CYPC, PPIC |
| The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 23kDa |
| NCBI: | 5480 |
| UniProt: | P45877 |
| Reinheit: | Affinity purification |
| Sequenz: | SSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW |
| Target-Kategorie: | PPIC |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human, ResearchArea: Signal Transduction,Immunology Inflammation. |

