CCL27 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A9864
Artikelname: CCL27 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A9864
Hersteller Artikelnummer: A9864
Alternativnummer: ABB-A9864-100UL,ABB-A9864-20UL,ABB-A9864-1000UL,ABB-A9864-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ALP, ILC, CTAK, CTACK, PESKY, ESKINE, SCYA27, CCL27
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation.
Molekulargewicht: 13kDa
NCBI: 10850
UniProt: Q9Y4X3
Reinheit: Affinity purification
Sequenz: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Target-Kategorie: CCL27
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway.
Western blot analysis of various lysates using CCL27 Rabbit pAb (A9864) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.